PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT21988
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family WRKY
Protein Properties Length: 198aa    MW: 21976.8 Da    PI: 10.3043
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT21988genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.33.1e-333188259
              --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
              +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers+edp+vv++tYeg+H h+
  EMT21988 31 EDGYRWRKYGQKAVKNSPFPRSYYRCTNSKCTVKKRVERSSEDPSVVITTYEGQHCHH 88
              8*******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.6E-341589IPR003657WRKY domain
SuperFamilySSF1182901.11E-282289IPR003657WRKY domain
PROSITE profilePS5081129.7122590IPR003657WRKY domain
SMARTSM007749.9E-393089IPR003657WRKY domain
PfamPF031062.8E-263188IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MKPTAAVKKG QKRARQQRFA FVTKSEVDHL EDGYRWRKYG QKAVKNSPFP RSYYRCTNSK  60
CTVKKRVERS SEDPSVVITT YEGQHCHHQT SFQRGGMHFH GGATVALAEQ MSFVSTQQLY  120
NLPPLRRQQM NPASSESVVS SVPPSLQQLN GGDELRRSTS YSPMPSAAQT SSSSLVPPDV  180
SFDMGLLGDI VPPGVRNG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-2723871074Probable WRKY transcription factor 4
2lex_A3e-2723871074Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1612VKKGQKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3702990.0AK370299.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2108G21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229639.18e-85PREDICTED: probable WRKY transcription factor 48
RefseqXP_003559239.18e-85PREDICTED: probable WRKY transcription factor 48
RefseqXP_010229633.18e-85PREDICTED: probable WRKY transcription factor 48
TrEMBLM8BJP11e-147M8BJP1_AEGTA; Putative WRKY transcription factor 57
STRINGMLOC_59259.21e-128(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21253796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.23e-54WRKY DNA-binding protein 57